PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G15930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 362aa    MW: 39313.2 Da    PI: 6.7839
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G15930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k++G g+W+t ++  g+ R++k+c++rw +yl
  LPERR07G15930.1 14 KGPWTPEEDEKLVAYIKEHGQGNWRTLPKNAGLSRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.42.8e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  LPERR07G15930.1  67 RGRFSFEEEEAIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.48965IPR017930Myb domain
SuperFamilySSF466899.36E-3211108IPR009057Homeodomain-like
SMARTSM007178.8E-171363IPR001005SANT/Myb domain
PfamPF002494.0E-171461IPR001005SANT/Myb domain
CDDcd001671.90E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
SMARTSM007178.3E-1766114IPR001005SANT/Myb domain
PROSITE profilePS5129420.76866116IPR017930Myb domain
PfamPF002491.8E-1567111IPR001005SANT/Myb domain
CDDcd001679.97E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRAPCCEKS GLKKGPWTPE EDEKLVAYIK EHGQGNWRTL PKNAGLSRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEEAIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLSSLLL KPSAAATSYY PTQADLDTLR ALEPLAGYPD LLRLAASTLL  180
PAATTGAAEQ AQLLLPWLLQ AQMAQQSAAA MAPAPQSAAT GGEQFACQMP GLVHASPTAQ  240
QQMAQDHVAA TCVQHASYDD ASHQLDYVSP ALMQMASTTT DASNLQQQWS STVTSSNNYN  300
NNNVNSRVST PSSSPAAAGR MNSSSTTKTT TYGLNASGDV IVDDAGLLDM HLSELLDVSD  360
YM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY114150.0Y11415.1 O.sativa mRNA for myb factor, 1355 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657827.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0D9X0A50.0A0A0D9X0A5_9ORYZ; Uncharacterized protein
STRINGOB07G24240.11e-180(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-87MYB-like 102